La mise en place de l'appareil génital chez l'être humain

Licence de l'article
Présentation

Explication de la mise en place de l'appareil génital, et notamment des gonades, au cours du développement embryonnaire chez l'être humain. Contrôle génétique et contrôle hormonal.

Introduction

L’appareil génital se met en place lors du développement embryonnaire. Ce phénomène est sous le contrôle de plusieurs gènes et hormones, en relation avec les chromosomes sexuels présents. Le début de ce développement est commun chez l’homme et la femme. Les étapes suivantes permettent d’aboutir à un appareil génital définitif masculin ou féminin.

Bases génétiques de la détermination du sexe

Premières hypothèses

Figure 1 : Caryotype d’un homme et d’une femme

Caryotype d'un homme XY Caryotype d'une femme XX

À gauche : caryotype d’un homme XY
À droite : caryotype d’une femme XX.
Source :
université Paris V – René Descartes.
Cliquer sur les images pour une image agrandie.

Les cellules du corps humain contiennent, dans leur noyau, 23 paires de chromosomes, portant les gènes. Ce bagage génétique provient de la mère (23 chromosomes) et du père (23 chromosomes). La 23e paire est différente selon le sexe : les femmes héritent d’un chromosome X de chaque parent ; tandis que les hommes ont un chromosome Y provenant de leur père et un chromosome X venant de leur mère. Les femmes sont donc XX et les hommes XY.

Or, on sait que chez certaines espèces animales (la drosophile, par exemple), le sexe est déterminé par le nombre de chromosomes X (plus précisément, par le rapport entre le nombre de chromosomes X et le nombre d’autosomes). Il est alors possible de supposer un tel mode de contrôle génétique du sexe : le nombre de chromosomes X déterminerait le sexe.

Toutefois, cette première hypothèse est contredite par l’observation d’anomalies chromosomiques touchant les chromosomes sexuels : les anomalies hétérosomales.

Les anomalies hétérosomales

On peut observer un certain nombre d’anomalies dans le nombre de chromosomes sexuels présentés par certains individus. Selon les cas, ces anomalies conduisent à des individus présentant un phénotype mâle, ou un phénotype femelle :

Figure 2 : Anomalies chromosomiques touchant les chromosomes sexuels

 
  Femelles Mâles
Stériles

X0 : Absence d’un chromosome X. Le syndrome de Turner touche environ une naissance sur 2500 avec un avortement précoce dans 99 % des cas.

Y0 : Absence du chromosome Y. Cette anomalie est létale.
XXY : Présence d’un chromosome X surnuméraire. Le syndrome de Klinefelter représente environ une naissance sur 700.
XXYY, XXXY, XXXXY ou XXX/XY : Présence de chromosomes surnuméraires. Ce pseudo-Klinefelter est une anomalie très rare.

Fertiles

XXX : Présence d’un chromosome X surnuméraire. 1/500 naissances. Sujet normal.

XXX : Présence d’un chromosome X surnuméraire. 1/500 naissances. Sujet normal.

Ces observations montrent que le sexe phénotypique de l’individu ne semble pas lié au nombre de X mais plutôt à la présence ou l’absence du Y :

  • absence de Y : phénotype féminin ;
  • présence de Y : phénotype masculin.

Le chromosome Y a donc un rôle fondamental dans la détermination du sexe. On peut alors chercher à préciser les éléments génétiques portés par ce chromosome qui déterminent ce phénotype sexuel masculin.

Les inversions sexuelles

On observe quelques rares cas de naissances d’individus intersexués, c’est-à-dire présentant une inversion sexuelle. Leur phénotype sexuel ne correspond pas aux chromosomes sexuels observables dans leurs caryotypes :

  • XX : mâle XX stérile ; 1/20 000 naissances ;
  • XY : femelle XY stérile ; 1/10 000 naissances.

On explique ce phénomène par des évènements de mutation ou de translocations. En effet, les chromosomes X et Y présentent, aux extrémités de leur bras, des régions homologues : régions pseudo-autosomiques PAR 1 sur le bras court et PAR 2 sur le bras long. Les inversions sexuelles proviendraient donc, en fait, d’une translocation d’un facteur au niveau de la région PAR 1, lors de la méiose, par crossing-over entre les chromosomes X et Y. Ce facteur a été nommé « facteur de détermination testiculaire » (TDF/ Testis Determining Factor), localisé juste en dessous de PAR1.

Figure 3 : Recombinaison génétique chez l’homme

 
Recombinaison génétique chez l'homme

Cliquer sur l’image pour voir une version agrandie.
1 : les chromosomes X et Y possèdent deux courtes régions identiques (régions pseudo-autosomales PAR 1 et PAR 2), représentées en vert (chromosome Y) et en mauve (chromosome X) sur ce schéma. Le gène SRY est situé à proximité de la région PAR 1 du chromosome Y.
2 : évènement de crossing-over entre X et Y, lors de la prophase I de méiose chez l’homme, permis par l’appariement des régions PAR 1 et PAR 2.
3 : chromosomes sexuels obtenus suite au crossing-over. La suite de la méiose permet la séparation des chromatides.
4 : les quatre chromatides obtenues suite à la méiose. Chaque gamète formé hérite d’une de ces chromatides.

Figure 4 : Caryotype après fécondation avec un ovule

Caryotype après fécondation

La fécondation avec un ovule (qui amène un chromosome X) aboutit à 4 zygotes diploïdes, de génotypes différents. La présence de SRY conduit à un phénotype masculin, quel que soit le caryotype : XX ou XY.

Par la suite, il a été possible de démontrer que le TDF était en réalité un seul gène, appelé SRY (Sex-determining Region of Y chromosome). Ce gène s’exprime lors du développement sexuel des gonades chez l’homme. Dans les cas de translocations, il serait donc absent sur le chromosome Y et présent sur le chromosome X. De même, des mutations dans le gène SRY (le rendant non fonctionnel) conduisent à l’obtention d’individus XY, mais de phénotype féminin.

Le gène SRY et son domaine HMG

La détermination du sexe gonadique dépend donc de la présence du gène SRY. Chez les individus de sexe masculin, la protéine issue de l’expression de SRY agirait en déclenchant une cascade d’autres gènes. La protéine SRY possède un domaine HMG (High Mobility Group), permettant à cette protéine de se fixer sur l’ADN.

La protéine SRY est composée de 204 acides aminés. Sa fixation sur l’ADN bicaténaire induit une courbure de celui-ci de 70° à 80° :

Figure 5 : Fixation de la protéine SRY sur l’ADN

Schéma des différents domaines de la protéine Sry
A : Schéma des domaines de la protéine SRY.
Structure 3D de la protéine Sry
B : Vue en 3D de la protéine SRY fixée à l'ADN.
C : Animation explicative. La protéine Sry (en bleu) se fixe à l'ADN (en rouge - vert) en le courbant de 70 à 80°

Cette courbure de l’ADN, suite à la fixation de SRY, aurait pour conséquence de permettre le rapprochement et l’interaction des facteurs de transcription contrôlant la différenciation des gonades. Ceci permettrait donc de déclencher l’expression de gènes menant à la formation du testicule, et des autres structures génitales masculines.

Le gène SRY est retrouvé chez tous les Mammifères, où il semble toujours jouer ce rôle de déterminant masculin.

Figure 6 : Comparaison de la structure de la protéine SRY chez trois Mammifères : l’homme, le gorille et la souris

Comparaison de la structure de la protéine Sry chez trois mammifères: l'homme, le gorille et la souris.
Cliquer sur le schéma pour accéder aux trois séquences complètes alignées.

Malgré les nombreuses différences entre les trois séquences de l’homme, du gorille et de la souris, une partie présente le plus d’homologie entre les trois espèces. Elle correspond en fait à la séquence de la boîte HMG. Même s’il est plus ou moins long, tous les Mammifères possèdent ce gène.

Différenciation morphologique de l’appareil génital

Bien que le sexe de l’embryon soit déterminé par la présence des chromosomes X et Y dès la fécondation, la gonade embryonnaire des Mammifères passe par un stade indifférencié. Pendant ce stade indifférencié, elle ne possède aucun caractère mâle ou femelle. Cette différenciation se réalise dans un second temps.

Première étape : formation d’une ébauche de gonade indifférenciée

Crête génitale et cellules germinales

Au début de l’organogenèse, on observe la formation d’une crête génitale (voir figure 7) qui est colonisée par les cellules germinales. La crête génitale est issue (de même que les reins) du mésoderme intermédiaire, situé entre le mésoderme latéral et les somites. Les cellules germinales proviennent d’une région mésodermique extracellulaire chez les Mammifères (voir figures 8 et 9).

Figure 7 : Représentation schématique d’un embryon de Vertébré au début de l’organogenèse, en coupe transversale

 
représentation schématique d'un embryon de Vertébré au début de l'organogenèse, en coupe transversale.

Le mésoderme intermédiaire se forme entre les somites et le mésoderme latéral. Il comporte les crêtes génitales (futures gonades), et les tissus néphrétiques (mésonéphros, au niveau de ces crêtes génitales, qui donnera les conduits génitaux), ou encore métanéphros plus postérieurement (qui donnera les reins chez les Mammifères, non visible sur schéma).
D : face dorsale ;
V : face ventrale.

Figure 8 : Migration des cellules germinales chez les Mammifères

migration des cellules germinales chez les Mammifères

Les cellules germinales migrent, chez tous les Vertébrés, pour aller coloniser la crête génitale. Chez les Mammifères, ces cellules sont originaires du mésoderme extra-embryonnaire. Elles accomplissent leur migration en passant par l’allantoïde.

Figure 9 : Colonisation de la crête génitale par les cellules germinales

colonisation de la crête génitale par les cellules germinales

Il est possible de marquer les cellules germinales, ce qui permet de suivre leur devenir dans l’embryon. La photographie ci-contre présente des cellules germinales arrivant dans la crête génitale, chez un Amphibien. On observerait des images très semblables chez un Mammifère. (La différence entre Amphibiens et Mammifères a surtout lieu dans le moment de cette migration : au cours du développement embryonnaire chez les Mammifères, et au cours de la métamorphose chez les Amphibiens)
M : mésentère dorsal.
G : cellules germinales.
cg : crête génitale.
cm : blastème (crête) mésonéphrétique
Photo : M. Delarue, Biologie et Multimédia

Développement de la crête génitale

L’ébauche de la gonade peut, au cours de son développement, se développer soit en ovaire soit en testicule, selon ses déterminants génétiques. Elle apparaît, chez l’Homme, dans le mésoderme intermédiaire pendant la quatrième semaine de développement, et se développe d’abord de la même manière chez les deux sexes jusqu’à la septième semaine. Voir figure 10.

L’épithélium de la crête génitale se développe dans le tissu conjonctif ; il se forme alors des cordons sexuels primitifs qui s’entourent de cellules germinales. Ces cordons sexuels vont proliférer jusqu’à la huitième semaine dans le tissu conjonctif.

Deuxième étape : formation d’une gonade

Formation d’une gonade mâle

Pour les fœtus XY, on observe dans la crête génitale la formation de deux types de cordons : les cordons testiculaires qui contiennent les cellules germinales qui produiront les futurs spermatozoïdes ; et les cordons du rete testis qui se trouvent à l’extrémité des cordons testiculaires. Le canal de Wolff est relié aux cordons du rete testis par des restes du tube mésonéphrétique et se différencie en canal déférent pour permettre la sortie des spermatozoïdes. Au cours de ce développement, les cellules du mésenchyme interstitiel des testicules vont devenir les cellules de Leydig (production de la testostérone qui favorise le maintien du canal de Wolff) et les cellules des cordons testiculaires, autres que les cellules germinales, vont se différencier en cellules de Sertoli (nutrition des spermatozoïdes et sécrétion de l’hormone anti-Müllerienne qui favorise la dégénérescence du canal de Müller). Pour un schéma voir la figure 10.

Pendant la puberté, il y a formation des tubes séminifères par creusement des cordons testiculaires, et les cellules germinales produisent les spermatozoïdes.

Formation d’une gonade femelle

Chez les fœtus de type femelle ou XX, les cordons sexuels primitifs dégénèrent. Néanmoins, l’épithélium de surface produit de nouveaux cordons qui ne pénètrent pas dans le tissu conjonctif mais qui restent en contact avec la surface corticale de la crête génitale. Ils forment les amas cellulaires différenciés de la granulosa (d’origine somatique) et entourent les cellules germinales. Les cellules des thèques (cellules périphériques et protectrices) se forment ensuite autour de chaque ensemble (granulosa + cellule germinale), pour former les follicules. Ces follicules secrètent des hormones stéroïdes. La formation d’un follicule n’est possible que s’il entoure une cellule germinale. Pour un schéma voir la figure 10.

Pour les individus XX, on observe une dégénérescence du canal de Wolff par l’absence de testostérone et le canal de Müller se développe pour former l’appareil génital femelle (l’oviducte, l’utérus, le canal cervical et le vagin supérieur).

Figure 10 : De la gonade indifférenciée à la gonade différenciée chez l’Homme

 
De la gonade indifférenciée à la gonade différenciée chez l'Homme

Cliquez sur l’image pour voir une version agrandie.
Première étape : développement identique chez l’homme et la femme
A
. À 4 semaines de développement, la crête génitale est visible. Elle comporte les cellules germinales. Elle se développe à côté de la crête mésonéphrétique, qui comporte le futur canal de Wolff.
B. Après 6 semaines de développement, le canal de Müller est apparu dans la crête mésonéphrétique. Les cordons sexuels primitifs se développent à partir de l’épithélium de la crête génitale.
Deuxième étape : développement différent chez l’homme et la femme
C
. Au stade 8 semaines, les cordons sexuels, pour les fœtus de type mâle ou XY, vont se développer en pénétrant dans le tissu conjonctif et former un réseau relié au niveau interne par les cordons du rete testis. L’extrémité de l’ensemble des cordons sexuels va se détacher de l’épithélium de la crête génitale. Ces cordons seront séparés par une matrice extracellulaire, l’albuginée.
D. Au stade 16 semaines, les cordons sexuels ou testiculaires contenant des cellules germinales (précurseurs des gamètes) se développent, augmentant alors la taille du testicule. Le réseau formé par les cordons testiculaires et les cordons du rete testis est relié au canal déférent (tube dans lequel les spermatozoïdes passent dans l’urètre et sortent de l’organisme) par des restes de tube mésonéphrétique (canaux efférents).
E. Au stade 8 semaines, les cordons sexuels primitifs dégénèrent ; seul l’épithélium de surface reste et produit des cordons corticaux.
F. Au stade 20 semaines, la folliculogénése, c’est-à-dire la formation des follicules, démarre. On observe une migration des follicules entourant l’ovogonie dans la crête génitale, mais il n’y a pas de connexions avec le canal de Müller.

Figure 11 : Testicule embryonnaire

Photo testicule embryonnaire

Testicule humain (5 mois 1/2) : On peut voir l’albuginée (dense et fibreuse), contenant des vaisseaux sanguins en développement, ainsi que les tubes séminifères en formation, convergeant vers la droite de la photographie.
La barre mesure 1 mm.
Photographie issue du site
internet de l’Université du Kansas.

Troisième étape : acquisition du sexe phénotypique

Les gonades en développement secrètent un certain nombre d’hormones. En particulier, le testicule secrète testostérone et hormone anti-Müllerienne. Ces hormones permettent le développement de l’ensemble de l’appareil génital vers un phénotype mâle ou femelle. Cette acquisition du sexe phénotypique est visible en particulier au niveau des canaux de Wolff et de Müller :

  • Au stade indifférencié de l’appareil génital, les canaux de Wolff et de Müller sont présents.
  • Les canaux de Wolff constituent le spermiducte chez le mâle des Vertébrés. Ils sont en relation avec le mésonéphros mis en place au cours de la quatrième semaine du développement. L’extension du canal de Wolff jusqu’à l’urètre se fait pendant la cinquième semaine. Ces canaux dégénèrent chez la femelle.
  • Les canaux de Müller se développent en parallèle aux canaux de Wolff par une invagination de l’épithélium au niveau du pronéphros (région antérieure du mésonéphros) au cours de la sixième semaine. Ils deviendront les oviductes de la femelle et déboucheront dans l’utérus. Ces canaux dégénèrent chez le mâle.

Figure 12 : Différenciation des voies génitales

 
Cliquer sur les boutons de contrôle pour démarrer l'animation.

Contrôle génétique des différentes étapes

Rappel : le rôle central de SRY

L’étude de cas d’inversions sexuelles a permis de mettre en évidence le rôle fondamental du gène SRY dans le déterminisme sexuel. La présence et l’expression de ce gène détermine une différenciation vers un phénotype masculin.

L’expression du gène SRY coïncide, de plus, avec la période du déterminisme sexuel. Il s’exprime spécifiquement dans les cellules somatiques de crêtes génitales mâles. La transcription du gène s’effectue encore après la différenciation des cellules de Sertoli pour déterminer l’expression des cellules germinales méiotiques et post-méiotiques.

L’implication de SRY dans la masculinisation a été démontré par plusieurs observations et expériences :

  • une mutation dans ce gène, rendant la protéine non fonctionnelle, conduit à une féminisation,
  • des souris de caryotype XX, ayant reçu une copie du gène SRY par transgenèse, sont masculinisées.

Toutefois, il faut garder à l’esprit que SRY n’est pas le seul acteur de cette différenciation de l’appareil génital : de nombreux autres facteurs interviennent, aussi bien avant l’expression de SRY, qu’après le début de son expression. Chez l’homme, SRY interviendrait dans le contrôle de l’expression des facteurs permettant ensuite le développement de l’appareil génital mâle. Ainsi, la séquence de fixation à l’ADN de SRY a été identifié dans la région promotrice de certains gènes contrôlant la différenciation sexuelle mâle.

Les grandes étapes du contrôle génétique

L’expression de plusieurs gènes permet, dans un premier temps, le développement des crêtes génitales en gonades indifférenciées. Les évènements diffèrent ensuite selon le sexe :

Chez l’homme

Le gène SRY ne s’exprime que dans les crêtes génitales, au niveau des cellules de soutien. Ces cellules se différencient alors en cellules de Sertoli, dans les cordons testiculaires. Dans le même temps, d’autres cellules sont induites par ces cellules de Sertoli pour former les cellules de Leydig dans le mésenchyme qui se développe entre les cordons testiculaires. Les hormones stéroïdes sont ensuite synthétisées dans les cellules de Leydig pour continuer la différenciation en organes génitaux mâles, internes et externes, alors que la synthèse d’AMH (hormone anti-müllerienne) par les cellules de Sertoli permet la régression du canal de Müller.

Chez la femme

En l’absence de SRY, les cellules de soutien se différencient en cellules folliculeuses, entourant les cellules germinales. Au contraire de ce qui se passe chez l’homme, l’entrée en méiose de ces cellules germinales n’est pas inhibée : elles deviennent des ovogonies. Les cordons sexuels dégénèrent.
Cette différenciation ovarienne est permise par le gène DAX1 (dont l’expression persiste, au contraire des testicules) et le déterminant génique sexuel Wnt4a. DAX1 permet d’inhiber les gènes impliqués dans la masculinisation.

L’expression des œstrogènes par l’ovaire en développement permet l’acquisition des caractères sexuels féminins (maintien et différenciation du canal de Müller). L’absence des hormones testiculaires induit la disparition du canal de Wolff.

Les caractères sexuels secondaires, ainsi que l’apparence « homme » ou « femme » se réalise ensuite sous l’action des hormones produites par les gonades différenciées.

Schéma récapitulatif du contrôle génétique des étapes de la différenciation sexuelle

Vous pouvez cliquer sur les gènes et hormones du schéma pour accéder à de courts descriptifs.

Figure 13 : Schéma récapitulatif du contrôle génétique des étapes de la différenciation sexuelle

 
Schéma récapitulatif du contrôle génétique des étapes de la différenciation sexuelle

ADN : Acide désoxyribonucléique
AMH : Hormone anti-müllerienne
DAX 1 : « DNA Sequence Driving Adrenal Cortical Cell-Specific Expression"
HMG : High Mobility Group
Œstrogènes : Hormones stéroïdes femelles
SF 1 : Steroidogenic Factor 1
SOX 9 : SRY-HMG Box
SRY : Sex-determining Region of Y chromosome
TDF : Testis Determining Factor
Testostérone : Hormone stéroïde mâle
WT 1 : Wilms Tumor 1

Références

Annexe : Comparaison des protéines SRY d’Homme, de Gorille et de Souris

Les étoiles (*) indiquent les acides aminés conservés entre ces trois espèces, les points (.) une conservation entre l’Homme et le Gorille.
Noter la très grande conservation d’un domaine central (correspondant à la boîte HMG), alors que le reste de la séquence est très divergent.

   homme   MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV
   gorille MQSYASAMLSVFNSDDYSPAVQQTIPAHRRSSSFLCTESCNSKYQCETGENSKGSVQDRV
   souris  --------------------------------------------------------EGHV
           ......................  ... .......................... ....*

   homme   KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
   gorille KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
   souris  KRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILH
           *******.****..*.*.*..**.*.*.*******..**.******.*******.*...*

   homme   REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNR----LYRDDCTKATHSRM
   gorille REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNR----LYRDDCTKATHSRM
   souris  REKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYS
           *********.*.*.**.......*.**.....*....*.*..    .**.*...*.*... 

   homme   EHQ-----------LGHLPPINAASSPQQRDRYSHWTKL---------------------
   gorille EHQ-----------LGHLPPINAASSPQQRDRYSHWTKL---------------------
   souris  KNQQSFYWQPVDIPTGHLQQQQQQQQQQQFHNHHQQQQQFYDHHQQQQQQQQQQQQFHDH
           ..*           .***.........**..........

   homme   ------------------------------------------------------------
   gorille ------------------------------------------------------------
   souris  HQQKQQFHDHHQQQQQFHDHHHHHQEQQFHDHHQQQQQFHDHQQQQQQQQQQQFHDHHQQ
   

   homme   ------------------------------------------------------------
   gorille ------------------------------------------------------------
   souris  KQQFHDHHHHQQQQQFHDHQQQQQQFHDHQQQQHQFHDHPQQKQQFHDHPQQQQQFHDHH
   

   homme   ------------------------------------------------------------
   gorille ------------------------------------------------------------
   souris  HQQQQKQQFHDHHQQKQQFHDHHQQKQQFHDHHQQQQQFHDHHQQQQQQQQQQQQQFHDQ
   

   homme   ------------------------------
   gorille ------------------------------
   souris  QLTYLLTADITGEHTPYQEHLSTALWLAVS

Pour citer cet article

Amélie Sabouret, Gilles Furelaud, Nabila Devos, La mise en place de l'appareil génital chez l'être humain, Planet-Vie, Lundi 20 mai 2002, http://planet-vie.ens.fr/article/1487/mise-place-appareil-genital-etre-humain, voir